PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10015767m
Common NameCARUB_v10015767mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 358aa    MW: 40290 Da    PI: 7.6563
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10015767mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.53e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+++++ +G g+W++++++ g+ R++k+c++rw +yl
  Carubv10015767m 14 RGLWSPEEDEKLINYINSYGHGCWSSVPKHAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding48.42.2e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+++++E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
  Carubv10015767m  67 RGSFSPQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.352965IPR017930Myb domain
SuperFamilySSF466891.21E-2911108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002499.0E-171461IPR001005SANT/Myb domain
CDDcd001673.23E-131761No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2565116IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.50266116IPR017930Myb domain
PfamPF002493.3E-1467110IPR001005SANT/Myb domain
CDDcd001672.71E-1169109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIN SYGHGCWSSV PKHAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLMSHH  120
HHGHHLHHHH HHLSSMASLL TNLPYHNGFN PTTHVDDESS RFMSNIITTT NPTFITPSHL  180
SLQSPHVMTP LMFPTPREGD FKFINTNQSH QDNNLYNNFD ILSATAVINN HHQPLLSSSS  240
HDNDPQWPAL PDFPASTISS FQETLQDYDD ANKLNVFVTP YNDNAKKLSC GEVLEGKVLS  300
SSSPVSQDHG LLLPTSYNLQ MSTTGDHHHR VDSYINHMVI PSSSSSSPIS CGQYVIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195880.0AY519588.1 Arabidopsis thaliana MYB transcription factor (At3g13890) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006299589.10.0hypothetical protein CARUB_v10015767mg
SwissprotQ9SPG30.0MYB26_ARATH; Transcription factor MYB26
TrEMBLR0G9Y80.0R0G9Y8_9BRAS; Uncharacterized protein
STRINGAT3G13890.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM128031930
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.20.0myb domain protein 26